DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6980 and CG43163

DIOPT Version :9

Sequence 1:	NP_651289.1	Gene:	CG6980 / 42955	FlyBaseID:	FBgn0039228	Length:	250	Species:	Drosophila melanogaster
Sequence 2:	NP_001246673.1	Gene:	CG43163 / 38966	FlyBaseID:	FBgn0262719	Length:	2523	Species:	Drosophila melanogaster

Alignment Length:	157	Identity:	46/157 - (29%)
Similarity:	63/157 - (40%)	Gaps:	34/157 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   104 KSFMEQVEKDANDRAEARAKAEYEAELQRSQGNEAFRSQKYEKAI--LHYDKAIIKVKDSAITYC 166
            |.:.||:|     ||:.:..|..||:...:.|........||.||  |......::......|..
  Fly   822 KCYQEQLE-----RAQEQRDAAVEAQAHGNLGIARLNMAHYEAAIGCLEAQLGTLERVSLPSTQA 881

  Fly   167 NRAL-------CYIKLQNYKRALK--DCQYVLEKLQESNLRAWLYQAHAYKGLKQDDK------- 215
            :||.       ||..|.:|:.|||  |.|..|    ...|.:...|..||:||.|..:
  Fly   882 DRARALGHLGDCYAALGDYEEALKCHDRQLQL----ALGLTSHRDQERAYRGLGQARRALGQLPA 942

  Fly   216 ----FEESVVKARE-HNP--KQLAYID 235
                .|:.:|.|.| |:|  |.|||.|
  Fly   943 ALVCLEKRLVVAHELHSPEIKALAYGD 969

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6980	NP_651289.1	TPR_11	127..190	CDD:290150	20/73 (27%)
		TPR repeat	128..156	CDD:276809	7/29 (24%)
		TPR repeat	161..192	CDD:276809	13/39 (33%)
		TPR_1	162..190	CDD:278916	12/36 (33%)
		TPR repeat	197..225	CDD:276809	10/38 (26%)
CG43163	NP_001246673.1	TPR_11	70..130	CDD:290150
		TPR repeat	98..128	CDD:276809
		TPR_11	101..164	CDD:290150
		TPR repeat	133..161	CDD:276809
		TPR repeat	243..269	CDD:276809
		TPR repeat	281..311	CDD:276809
		TPR_12	282..353	CDD:290160
		TPR_12	320..393	CDD:290160
		TPR repeat	321..349	CDD:276809
		TPR repeat	354..390	CDD:276809
		TPR_12	401..473	CDD:290160
		TPR repeat	401..429	CDD:276809
		TPR_7	403..438	CDD:289919
		TPR repeat	441..469	CDD:276809
		TPR	467..752	CDD:223533
		TPR repeat	482..509	CDD:276809
		TPR repeat	522..549	CDD:276809
		TPR repeat	561..595	CDD:276809
		TPR repeat	600..630	CDD:276809
		TPR repeat	642..669	CDD:276809
		TPR_7	643..677	CDD:289919
		TPR repeat	680..716	CDD:276809
		TPR repeat	721..749	CDD:276809
		TPR_7	723..758	CDD:289919
		TPR repeat	801..829	CDD:276809	3/6 (50%)
		TPR_12	841..914	CDD:290160	20/76 (26%)
		TPR repeat	841..878	CDD:276809	7/36 (19%)
		TPR_12	882..949	CDD:290160	19/70 (27%)
		TPR repeat	883..913	CDD:276809	11/29 (38%)
		TPR	884..914	CDD:197478	11/33 (33%)
		TPR repeat	924..949	CDD:276809	5/24 (21%)
		TPR_12	964..1036	CDD:290160	4/6 (67%)
		TPR repeat	964..998	CDD:276809	4/6 (67%)
		TPR repeat	1004..1032	CDD:276809
		TPR repeat	1043..1073	CDD:276809
		TPR_12	1044..1112	CDD:290160
		TPR_7	1046..1078	CDD:289919
		TPR_12	1081..1153	CDD:290160
		TPR repeat	1081..1109	CDD:276809
		CHAT	1421..1718	CDD:289536
		Treacle	<1957..2287	CDD:281536
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0548
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900