DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and Sgt

DIOPT Version :10

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_609842.1 Gene:Sgt / 35052 FlyBaseID:FBgn0032640 Length:331 Species:Drosophila melanogaster


Alignment Length:117 Identity:38/117 - (32%)
Similarity:61/117 - (52%) Gaps:7/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 AELQRSQGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKL 192
            ||..:::||...:..||.:|:|.|::||.....:.|.|||||..:|:|...:||:.||:..|  :
  Fly   116 AESIKNEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDCKSAL--V 178

  Fly   193 QESNL-RAWLYQAHAYKGLKQDDKFEESVVKAREHNPKQLAYIDKYIKQLEA 243
            ..:|. :|:.....||..:...:|.|::..||.|..|..    :.|...|||
  Fly   179 YNNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDN----EVYKSNLEA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 Spy 117..>233 CDD:443119 34/105 (32%)
TPR repeat 128..156 CDD:276809 10/27 (37%)
TPR repeat 161..192 CDD:276809 13/30 (43%)
TPR repeat 197..225 CDD:276809 7/28 (25%)
SgtNP_609842.1 SGTA_dimer 7..>48 CDD:465168
TPR 116..>233 CDD:440225 38/117 (32%)
TPR repeat 116..144 CDD:276809 10/27 (37%)
TPR repeat 149..179 CDD:276809 13/31 (42%)
TPR repeat 184..212 CDD:276809 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.