DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and Spag1

DIOPT Version :10

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001012116.1 Gene:Spag1 / 315033 RGDID:1310702 Length:893 Species:Rattus norvegicus


Alignment Length:205 Identity:60/205 - (29%)
Similarity:101/205 - (49%) Gaps:32/205 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EDSKAGGDAKEKI-----NFDNLDVDKVRLKVKENRTVINRKSLEEDNEKQVKDMNQKSFMEQVE 111
            |.|.....||::|     .:|..||:|...|:.           |:..||.|  :|.|:.:.::|
  Rat   145 ETSSKSKTAKKRIPRDYAEWDKFDVEKECSKID-----------EDYKEKTV--INNKAHLSKIE 196

  Fly   112 KDANDRAEARAKAEYEAELQRSQGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQ 176
            ...:.......:..:.|..::.:|||||.|..||:|:::|.:: :....:|..|.|||...||||
  Rat   197 TKIDTAGLTEKEKNFLANREKGKGNEAFYSGDYEEAVMYYTRS-LSALPTATAYNNRAQAEIKLQ 260

  Fly   177 NYKRALKDCQYVLEKLQESNLRAWLYQAHAYKGLKQDDKFEES------VVKAREHN---PKQLA 232
            .:..||:||:..|| |:..|::|.|.:|..|   |..:||.|:      |::|...|   .|.|:
  Rat   261 RWSSALEDCEKALE-LEPGNIKALLRRATTY---KHQNKFLEAVDDLRKVLQAEPDNDLAKKTLS 321

  Fly   233 YIDKYIKQLE 242
            .:::.:|..|
  Rat   322 EVERELKNSE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 Spy 117..>233 CDD:443119 41/124 (33%)
TPR repeat 128..156 CDD:276809 11/27 (41%)
TPR repeat 161..192 CDD:276809 15/30 (50%)
TPR repeat 197..225 CDD:276809 10/33 (30%)
Spag1NP_001012116.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..155 3/9 (33%)
TPR 1 213..246 11/33 (33%)
TPR repeat 217..241 CDD:276809 10/24 (42%)
TPR 218..>336 CDD:440225 42/119 (35%)
TPR repeat 246..275 CDD:276809 15/29 (52%)
TPR 2 247..279 15/32 (47%)
TPR 3 280..313 10/35 (29%)
TPR repeat 280..308 CDD:276809 9/30 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..344 2/8 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 349..368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..437
TPR 4 429..463
3a0801s09 <432..>569 CDD:273380
TPR repeat 432..458 CDD:276809
TPR repeat 466..500 CDD:276809
TPR 5 471..504
TPR repeat 505..533 CDD:276809
TPR 6 506..538
TPR 601..>713 CDD:440225
TPR 7 605..638
TPR repeat 606..633 CDD:276809
TPR repeat 638..668 CDD:276809
TPR 8 639..672
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 704..756
RPAP3_C 770..861 CDD:464012
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.