DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and Tomm34

DIOPT Version :10

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001037709.1 Gene:Tomm34 / 311621 RGDID:1309029 Length:309 Species:Rattus norvegicus


Alignment Length:123 Identity:41/123 - (33%)
Similarity:61/123 - (49%) Gaps:7/123 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SLEEDNEKQVKDMNQKSFMEQVEKDANDRAEARAKAEYEAELQRSQGNEAFRSQKYEKAILHYDK 153
            ||..:|.|:......|      |..|.......|.....|.:.:.:|||..:...::|||..|.:
  Rat   160 SLPSENHKETAKSKSK------ETTATKNRVPSAGDVERARVLKEEGNELVKKGNHKKAIEKYSE 218

  Fly   154 AIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQAHAYKGLK 211
            :::.....:.||.|||||::.|:.||.|.|||...| ||...|::|:..:|.|||.||
  Rat   219 SLLFSSLESATYSNRALCHLVLKQYKEAEKDCTEAL-KLDGKNVKAFYRRAQAYKALK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 Spy 117..>233 CDD:443119 34/95 (36%)
TPR repeat 128..156 CDD:276809 8/27 (30%)
TPR repeat 161..192 CDD:276809 15/30 (50%)
TPR repeat 197..225 CDD:276809 7/15 (47%)
Tomm34NP_001037709.1 TPR 1 9..42
TPR repeat 9..37 CDD:276809
3a0801s09 <11..>294 CDD:273380 41/123 (33%)
TPR repeat 50..80 CDD:276809
TPR 2 51..84
TPR repeat 85..113 CDD:276809
TPR 3 86..118
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..187 7/32 (22%)
TPR 4 193..226 8/32 (25%)
TPR repeat 193..221 CDD:276809 8/27 (30%)
TPR repeat 226..256 CDD:276809 15/30 (50%)
TPR 5 227..260 17/33 (52%)
TPR repeat 261..289 CDD:276809 7/15 (47%)
TPR 6 262..294 7/14 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.