DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and Ttc9c

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001007694.1 Gene:Ttc9c / 309196 RGDID:1359253 Length:171 Species:Rattus norvegicus


Alignment Length:154 Identity:38/154 - (24%)
Similarity:73/154 - (47%) Gaps:36/154 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 EAELQRSQGNEAFRSQKYEKAILHYDKAIIKVK----------------DSAIT----------- 164
            ||:|.:.:||:.:|..||..|:..|.:|:::::                ..|:|           
  Rat     7 EAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPIPNLGPQGPALTPEQENILHTIQ 71

  Fly   165 ---YCNRALCYIKLQ--NYKRALKDCQYVLEKLQESNLRAWLYQAH-AYKGLKQDDKFEESVVKA 223
               |.|.|.|.::::  .|:|..:..|.|||: |..|.:| ||:|. |:..|:..|:....::.|
  Rat    72 TDCYNNLAACLLQMEPVKYERVREYSQKVLER-QPENAKA-LYRAGVAFFHLQDYDQARHYLLAA 134

  Fly   224 REHNPKQLAYIDKYIKQLEADLKA 247
            ....||. |.:.:|::..:::|.:
  Rat   135 VNRQPKD-ANVRRYLQLTQSELSS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 21/94 (22%)
TPR repeat 128..156 CDD:276809 10/27 (37%)
TPR repeat 161..192 CDD:276809 12/46 (26%)
TPR_1 162..190 CDD:278916 10/43 (23%)
TPR repeat 197..225 CDD:276809 8/28 (29%)
Ttc9cNP_001007694.1 TPR 1 8..41 10/32 (31%)
TPR repeat 8..36 CDD:276809 10/27 (37%)
TPR repeat 45..103 CDD:276809 11/57 (19%)
TPR 2 72..107 11/35 (31%)
PEP_TPR_lipo <82..>152 CDD:274350 20/72 (28%)
TPR 3 108..141 9/33 (27%)
TPR repeat 108..135 CDD:276809 7/27 (26%)
TPR repeat 142..165 CDD:276809 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.