DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and Ttc12

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_006243066.1 Gene:Ttc12 / 300696 RGDID:1303264 Length:723 Species:Rattus norvegicus


Alignment Length:250 Identity:74/250 - (29%)
Similarity:123/250 - (49%) Gaps:28/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANEEVKDNAQLKATMLNCNLNPSVADDFAEFEATLAKIDCILQNKAPCDDEDSKAGGDAKEKIN 65
            ||:::.:|   |:..:.|       .|:.......:...|..:|.||..|.|         :|:.
  Rat    20 MADDQERD---LQRFLEN-------VDEITNLIQEMNSDDPFIQQKAVLDTE---------KKLL 65

  Fly    66 FDNLDVDKVRLKVKENRTVINRKSLEEDNEKQVKDMNQKSFMEQVEKDANDRAEARAKAEYEAEL 130
            ....:.::...:...|:|:|:.....|:    ..:||..:|:..|||||.:||:.|.:....|:.
  Rat    66 LMEREQEEDGCRTTLNKTMISPPQAPEN----ANEMNPDAFLASVEKDAKERAKRRRENRVLADA 126

  Fly   131 QRSQGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQES 195
            .:.:|||||....||.||..|.:.:.|:||..:.|.|||..||||.:|::||.||.:.| |..|:
  Rat   127 LKEKGNEAFVKGDYETAIFFYSEGLGKLKDMKVLYTNRAQAYIKLGDYQKALVDCDWAL-KCDEN 190

  Fly   196 NLRAWLYQAHAYKGLKQDDKFEESVVKAREHNPKQLAYIDKYIKQL----EADLK 246
            ..:|:.:...|:..||...|.:|...|..|.|||..|.:.:::.|:    :|||:
  Rat   191 CTKAYFHMGKAHLALKNYSKSKECYQKIGEINPKLKAQVKEHLNQVTLREKADLQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 27/62 (44%)
TPR repeat 128..156 CDD:276809 11/27 (41%)
TPR repeat 161..192 CDD:276809 14/30 (47%)
TPR_1 162..190 CDD:278916 13/27 (48%)
TPR repeat 197..225 CDD:276809 7/27 (26%)
Ttc12XP_006243066.1 TPR_11 124..189 CDD:290150 29/65 (45%)
TPR repeat 124..152 CDD:276809 11/27 (41%)
TPR repeat 157..187 CDD:276809 14/30 (47%)
TPR_11 160..223 CDD:290150 24/63 (38%)
TPR_1 161..191 CDD:278916 16/30 (53%)
TPR repeat 192..217 CDD:276809 6/24 (25%)
TPR_1 193..224 CDD:278916 9/30 (30%)
ARM 631..723 CDD:237987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm44459
orthoMCL 1 0.900 - - OOG6_108547
Panther 1 1.100 - - LDO PTHR46540
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.