DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6980 and Sugt1

DIOPT Version :9

Sequence 1:	NP_651289.1	Gene:	CG6980 / 42955	FlyBaseID:	FBgn0039228	Length:	250	Species:	Drosophila melanogaster
Sequence 2:	NP_001013069.1	Gene:	Sugt1 / 290408	RGDID:	1307550	Length:	336	Species:	Rattus norvegicus

Alignment Length:	81	Identity:	25/81 - (30%)
Similarity:	37/81 - (45%)	Gaps:	8/81 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   145 EKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQAHAYKG 209
            :.|:....||:.:..|.|..||.||.|:|.|..|...:.|.:..|| |..:|..|.|     .||
  Rat    28 QAALEELTKALEQNPDDAQYYCQRAYCHILLGKYCDGIADVKKSLE-LNPNNSTALL-----RKG 86

  Fly   210 LKQDDKFEESVVKARE 225
            :  .:.:|:....|.|
  Rat    87 I--CEYYEKDYASALE 100

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6980	NP_651289.1	TPR_11	127..190	CDD:290150	14/44 (32%)
		TPR repeat	128..156	CDD:276809	3/10 (30%)
		TPR repeat	161..192	CDD:276809	12/30 (40%)
		TPR_1	162..190	CDD:278916	10/27 (37%)
		TPR repeat	197..225	CDD:276809	6/27 (22%)
Sugt1	NP_001013069.1	TPR 1	11..44		3/15 (20%)
		PLN03088	21..336	CDD:215568	25/81 (31%)
		TPR repeat	44..74	CDD:276809	12/30 (40%)
		TPR 2	45..78		13/33 (39%)
		TPR	45..78	CDD:197478	13/33 (39%)
		TPR 3	79..112		7/29 (24%)
		TPR repeat	79..107	CDD:276809	7/29 (24%)
		p23_CS_hSgt1_like	146..229	CDD:107239
		SGS	256..336	CDD:282811
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0548
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900