DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and TTC9

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_056166.1 Gene:TTC9 / 23508 HGNCID:20267 Length:222 Species:Homo sapiens


Alignment Length:174 Identity:46/174 - (26%)
Similarity:71/174 - (40%) Gaps:48/174 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RAEARAKAEYEAELQR------SQGNEAFRSQKYEKAILHYDKAIIKVK-----------DS--- 161
            |.:..|.|| .|||.|      |||.:.::.:|:.:||..|.:|::::|           ||   
Human    41 RGQVGAAAE-PAELIRRAHEFKSQGAQCYKDKKFREAIGKYHRALLELKGLLPPPGERERDSRPA 104

  Fly   162 --------------------AI---TYCNRALCYI--KLQNYKRALKDCQYVLEKLQESNLRAWL 201
                                ||   .|.:.|.|.:  :|.||:|..:.|..||:| :..|.:|..
Human   105 SPAGALKPGRLSEEQSKTVEAIEIDCYNSLAACLLQAELVNYERVKEYCLKVLKK-EGENFKALY 168

  Fly   202 YQAHAYKGLKQDDKFEESVVKAREHNPKQLAYIDKYIKQLEADL 245
            ....|:..|...||....:.:||...|.....| :||:..|..|
Human   169 RSGVAFYHLGDYDKALYYLKEARTQQPTDTNVI-RYIQLTEMKL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 26/107 (24%)
TPR repeat 128..156 CDD:276809 12/33 (36%)
TPR repeat 161..192 CDD:276809 13/58 (22%)
TPR_1 162..190 CDD:278916 11/32 (34%)
TPR repeat 197..225 CDD:276809 6/27 (22%)
TTC9NP_056166.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 2/7 (29%)
TPR 1 56..89 8/32 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..116 3/27 (11%)
TPR 2 125..160 13/35 (37%)
TPR_11 127..195 CDD:290150 19/68 (28%)
TPR repeat 130..159 CDD:276809 10/28 (36%)
TPR 3 161..194 8/32 (25%)
TPR repeat 164..190 CDD:276809 5/25 (20%)
TPR_1 165..197 CDD:278916 8/31 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.