DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6980 and TTC28

DIOPT Version :9

Sequence 1:	NP_651289.1	Gene:	CG6980 / 42955	FlyBaseID:	FBgn0039228	Length:	250	Species:	Drosophila melanogaster
Sequence 2:	NP_001138890.1	Gene:	TTC28 / 23331	HGNCID:	29179	Length:	2481	Species:	Homo sapiens

Alignment Length:	146	Identity:	34/146 - (23%)
Similarity:	57/146 - (39%)	Gaps:	54/146 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly   122 AKAEYEAELQRSQGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQ 186
            :|||:..:::  |.|:|.....:..||:.|::|:.....:.|.|.||:..|:|:|.|.:||.|
Human    54 SKAEFVEKVR--QSNQACHDGDFHTAIVLYNEALAVDPQNCILYSNRSAAYMKIQQYDKALDD-- 114

  Fly   187 YVLEKLQESNLRAWLYQAHAYKGLKQDDKFEESVVKAREHNPK----------QLAYIDKYIKQL 241
                                             .:|||..|||          .|.|:.::...|
Human   115 ---------------------------------AIKARLLNPKWPKAYFRQGVALQYLGRHADAL 146

  Fly   242 EA-------DLKALEI 250
            .|       |.|:|::
Human   147 AAFASGLAQDPKSLQL 162

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6980	NP_651289.1	TPR_11	127..190	CDD:290150	18/62 (29%)
		TPR repeat	128..156	CDD:276809	7/27 (26%)
		TPR repeat	161..192	CDD:276809	11/30 (37%)
		TPR_1	162..190	CDD:278916	11/27 (41%)
		TPR repeat	197..225	CDD:276809	2/27 (7%)
TTC28	NP_001138890.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..48
		TPR 1	58..91		7/34 (21%)
		TPR_11	63..123	CDD:290150	21/96 (22%)
		TPR repeat	91..121	CDD:276809	14/64 (22%)
		TPR 2	93..125		16/66 (24%)
		TPR_11	94..157	CDD:290150	20/97 (21%)
		TPR 3	126..159		5/32 (16%)
		TPR repeat	126..154	CDD:276809	4/27 (15%)
		TPR repeat	160..188	CDD:276809	1/3 (33%)
		TPR 4	196..229
		TPR 5	234..267
		TPR repeat	236..262	CDD:276809
		TPR 6	274..307
		TPR repeat	274..306	CDD:276809
		TPR_11	275..345	CDD:290150
		TPR 7	314..347
		TPR_12	315..386	CDD:290160
		TPR repeat	316..342	CDD:276809
		TPR 8	354..387
		TPR repeat	354..382	CDD:276809
		TPR_7	357..391	CDD:289919
		TPR repeat	393..423	CDD:276809
		TPR 9	394..427
		TPR	394..426	CDD:197478
		TPR	414..717	CDD:223533
		TPR repeat	428..459	CDD:276809
		TPR 10	434..467
		TPR 11	474..507
		TPR repeat	475..502	CDD:276809
		TPR 12	514..547
		TPR repeat	515..542	CDD:276809
		TPR_7	516..551	CDD:289919
		TPR 13	554..587
		TPR repeat	554..582	CDD:276809
		TPR 14	594..627
		TPR repeat	594..622	CDD:276809
		TPR_7	596..631	CDD:289919
		TPR repeat	633..663	CDD:276809
		TPR 15	634..667
		TPR_7	636..670	CDD:289919
		TPR 16	674..707
		TPR	694..995	CDD:223533
		TPR repeat	712..739	CDD:276809
		TPR 17	714..747
		TPR 18	754..787
		TPR repeat	754..782	CDD:276809
		TPR 19	794..827
		TPR repeat	794..822	CDD:276809
		TPR repeat	833..863	CDD:276809
		TPR 20	834..867
		TPR 21	877..910
		TPR repeat	878..905	CDD:276809
		TPR_7	879..911	CDD:289919
		TPR repeat	916..950	CDD:276809
		TPR 22	917..950
		TPR 23	957..990
		TPR repeat	957..982	CDD:276809
		TPR_7	959..994	CDD:289919
		TPR 24	997..1030
		TPR repeat	997..1025	CDD:276809
		TPR_12	999..1067	CDD:290160
		TPR 25	1037..1070
		TPR repeat	1037..1065	CDD:276809
		TPR_12	1038..1109	CDD:290160
TPR repeat	1075..1105	CDD:276809
TPR 26	1077..1110
TPR_12	1079..1148	CDD:290160
TPR 27	1117..1150
TPR repeat	1117..1143	CDD:276809
TPR 28	1169..1202
TPR repeat	1169..1194	CDD:276809
CHAT	1390..1713	CDD:289536
Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2004..2055
Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2075..2161
Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2176..2339
Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2420..2467
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0548
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900