DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and sti-1

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001367444.1 Gene:sti-1 / 178587 WormBaseID:WBGene00019983 Length:320 Species:Caenorhabditis elegans


Alignment Length:209 Identity:50/209 - (23%)
Similarity:95/209 - (45%) Gaps:39/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GDAKEKINFDNLDVDKVRLKVKENRTVINRKSLEEDNEKQVKDMNQKSFMEQVEKDANDRAEARA 122
            |:|.:|.|..:|.|......:.|.|        :.:..|:||::.::  ::..|:.|....|.  
 Worm    87 GNAFQKQNDLSLAVQWFHRSLSEFR--------DPELVKKVKELEKQ--LKAAERLAYINPEL-- 139

  Fly   123 KAEYEAELQRSQGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQ- 186
                 |:.::::|||.|:...|..|:.||::|:.:..::||.|.|||.|..||..::|||.||. 
 Worm   140 -----AQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDT 199

  Fly   187 -----------YVLEKLQESNLRAWLYQAHAYKGLKQDDKFEE-------SVVKAREHNP---KQ 230
                       |:.:......:|.|.....||:...|.|...|       :.:::.:.:|   |:
 Worm   200 CIRLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVRNCLRSNDEDPEKAKE 264

  Fly   231 LAYIDKYIKQLEAD 244
            .:..|..::::..|
 Worm   265 RSLADPEVQEILRD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 25/74 (34%)
TPR repeat 128..156 CDD:276809 10/27 (37%)
TPR repeat 161..192 CDD:276809 15/42 (36%)
TPR_1 162..190 CDD:278916 15/39 (38%)
TPR repeat 197..225 CDD:276809 7/34 (21%)
sti-1NP_001367444.1 3a0801s09 <5..>241 CDD:273380 45/170 (26%)
TPR repeat 5..33 CDD:276809
TPR repeat 38..68 CDD:276809
TPR repeat 80..108 CDD:276809 6/20 (30%)
TPR repeat 140..168 CDD:276809 10/27 (37%)
TPR repeat 173..203 CDD:276809 14/29 (48%)
TPR repeat 208..236 CDD:276809 5/27 (19%)
STI1 259..311 CDD:407696 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.