DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and ttc-4

DIOPT Version :9

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_495087.1 Gene:ttc-4 / 173946 WormBaseID:WBGene00015916 Length:419 Species:Caenorhabditis elegans


Alignment Length:215 Identity:51/215 - (23%)
Similarity:92/215 - (42%) Gaps:38/215 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DNLDVDKVRLKVKENRTVINRKSLEEDNEKQVKDMNQ-KSFMEQVEKDA--NDRAEARAKAEYE- 127
            |:||.....:..:::.....||..:.|:  ..|:::| .:||.::..|.  .|..||....:|: 
 Worm    23 DDLDQFMEEMAARKSDKKEERKPFDFDD--WCKEIDQHPAFMTEMPTDGKYQDTIEALQSMKYDK 85

  Fly   128 ---------AELQRSQGNEAFRSQKYEKAILHYDKAIIK----VKDSAITYCNRALCYIKLQNYK 179
                     ||..:.:||:.|:.:||..|...|...|.:    .|.:|:.|.|||.....|.|.:
 Worm    86 EDDEDKQMNAEHHKEEGNKHFKFKKYRWATDCYSNGIKENSPDRKLNAVLYFNRAAAQKHLGNLR 150

  Fly   180 RALKDCQYVLEKLQESNLRAWLYQAHAYKGLKQDDKFEESVVKAREHNPKQLAYI---------- 234
            .|:|||. :..|...::|:..:..|.....|    ::.:..:...|.:.|..|:.          
 Worm   151 SAIKDCS-MGRKFDPTHLKGVIRGAECLLEL----EYAKDALNWIESSKKIFAFTKETSDTPDLT 210

  Fly   235 ---DKYIKQLEA-DLKALEI 250
               .|:|.|||. .:|::|:
 Worm   211 DDEKKFIDQLETLRVKSVEL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 22/76 (29%)
TPR repeat 128..156 CDD:276809 9/27 (33%)
TPR repeat 161..192 CDD:276809 11/30 (37%)
TPR_1 162..190 CDD:278916 11/27 (41%)
TPR repeat 197..225 CDD:276809 3/27 (11%)
ttc-4NP_495087.1 TPR_11 94..164 CDD:290150 23/70 (33%)
TPR repeat 95..123 CDD:276809 9/27 (33%)
TPR repeat 132..162 CDD:276809 11/30 (37%)
TPR repeat 167..191 CDD:276809 3/27 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R218
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.