DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6980 and STIP1

DIOPT Version :10

Sequence 1:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001269581.1 Gene:STIP1 / 10963 HGNCID:11387 Length:590 Species:Homo sapiens


Alignment Length:276 Identity:62/276 - (22%)
Similarity:109/276 - (39%) Gaps:84/276 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EDSKAGGDAKEKINFDNL--DVDKVRLKVKENRTVINRKS---LEEDNEKQVKDMNQKS------ 105
            ::.:.|.||.:|.:||..  ..||.:.....|.|.|..::   .|:.:..:.:::.:|:      
Human   274 KEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRE 338

  Fly   106 -------------------FMEQVEKDA-----NDRAEARA----KAEYEAEL------------ 130
                               |.|:..|||     ...||.|.    |...:||.            
Human   339 NREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYIN 403

  Fly   131 ------QRSQGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVL 189
                  ::::|||.|:...|.:|:.||.:||.:....|..|.|||.||.||..::.|||||:..:
Human   404 PDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECI 468

  Fly   190 EKLQESNLRAWLYQAHAYKGLKQDDKFEESVVKA-----------------------REHNP--- 228
            : |:.:.::.:..:|.|.:.:|...|..:...||                       |..:|   
Human   469 Q-LEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDV 532

  Fly   229 KQLAYIDKYIKQLEAD 244
            |:.|..|..::|:.:|
Human   533 KRRAMADPEVQQIMSD 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6980NP_651289.1 Spy 117..>233 CDD:443119 40/163 (25%)
TPR repeat 128..156 CDD:276809 11/45 (24%)
TPR repeat 161..192 CDD:276809 14/30 (47%)
TPR repeat 197..225 CDD:276809 6/50 (12%)
STIP1NP_001269581.1 3a0801s09 <54..579 CDD:273380 62/276 (22%)
TPR repeat 54..79 CDD:276809
TPR repeat 84..114 CDD:276809
TPR repeat 119..147 CDD:276809
TPR repeat 276..300 CDD:276809 8/23 (35%)
TPR repeat 305..335 CDD:276809 5/29 (17%)
TPR repeat 347..375 CDD:276809 5/27 (19%)
TPR repeat 411..435 CDD:276809 9/23 (39%)
TPR repeat 440..470 CDD:276809 14/30 (47%)
TPR repeat 475..503 CDD:276809 6/27 (22%)
TPR repeat 509..538 CDD:276809 4/28 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.