DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG6980 and SUGT1

DIOPT Version :9

Sequence 1:	NP_651289.1	Gene:	CG6980 / 42955	FlyBaseID:	FBgn0039228	Length:	250	Species:	Drosophila melanogaster
Sequence 2:	NP_001124384.1	Gene:	SUGT1 / 10910	HGNCID:	16987	Length:	365	Species:	Homo sapiens

Alignment Length:	66	Identity:	23/66 - (34%)
Similarity:	34/66 - (51%)	Gaps:	1/66 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   136 NEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAW 200
            ::|...:..:.|:....||:.:..|.|..||.||.|:|.|.||..|:.|.:..|| |..:|..|.
Human    19 SDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLE-LNPNNSTAM 82

  Fly   201 L 201
            |
Human    83 L 83

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG6980	NP_651289.1	TPR_11	127..190	CDD:290150	17/53 (32%)
		TPR repeat	128..156	CDD:276809	4/19 (21%)
		TPR repeat	161..192	CDD:276809	14/30 (47%)
		TPR_1	162..190	CDD:278916	12/27 (44%)
		TPR repeat	197..225	CDD:276809	2/5 (40%)
SUGT1	NP_001124384.1	TPR 1	11..44		4/24 (17%)
		PLN03088	21..365	CDD:215568	23/64 (36%)
		TPR repeat	44..74	CDD:276809	14/30 (47%)
		TPR 2	45..78		15/33 (45%)
		TPR 3	79..112		2/5 (40%)
		TPR repeat	79..107	CDD:276809	2/5 (40%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0548
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900