DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment polybromo and AT4G04260

DIOPT Version :9

Sequence 1:NP_651288.1 Gene:polybromo / 42954 FlyBaseID:FBgn0039227 Length:1654 Species:Drosophila melanogaster
Sequence 2:NP_001328826.1 Gene:AT4G04260 / 825742 AraportID:AT4G04260 Length:206 Species:Arabidopsis thaliana


Alignment Length:218 Identity:47/218 - (21%)
Similarity:80/218 - (36%) Gaps:48/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   927 GDYVYVQMPE-NKIPSICCIERLWTSPTNEKLMQASIFVRPHETYHVTTRKFLEKEVFKSSLSQT 990
            ||.|.::..: .|.|.:..:|::.....|...:....:..|.|::....:....||:|.|.....
plant     9 GDCVLMRPSDAGKAPYVARVEKIEADARNNVKVHCRWYYCPEESHGGRRQLHGAKELFLSDHFDV 73

  Fly   991 ISMDKVQGMCYVMNIKDYIKMRPENLPEKDVYVCESRYNIQGRWFKKLKSWPPVREGSSVKFVPR 1055
            .|...::|.|.|...|:|.::  ||:..:| |.|...|                 :.::..|.| 
plant    74 QSAHTIEGKCIVHTFKNYTRL--ENVGVED-YYCIFDY-----------------KAATGAFTP- 117

  Fly  1056 EQPLELKRVMSVFKERLEKHKGELEELKLQETLVEKEKPNVSCDPPPNAEVGSTYYQQYNTICSG 1120
                  .||...:|..:..:..||.||.|....|     :::|       ||.|..:        
plant   118 ------DRVAVYYKCEMPYNSDELMELLLCHYRV-----HLAC-------VGVTIEE-------- 156

  Fly  1121 AIKTGDFVYVATQTGKQSVAQVQ 1143
            |.|...||.|...:.:..|.:.|
plant   157 AKKLEHFVCVECSSDEDGVKRFQ 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
polybromoNP_651288.1 Bromodomain 46..158 CDD:295360
Bromo_polybromo_II 191..294 CDD:99948
Bromo_polybromo_III 335..443 CDD:99951
Bromo_polybromo_IV 512..613 CDD:99949
Bromo_polybromo_V 641..733 CDD:99946
Bromo_polybromo_VI 758..867 CDD:99956
BAH_polybromo 921..1040 CDD:240068 25/113 (22%)
BAH_polybromo 1120..1234 CDD:240068 7/24 (29%)
HMG-box 1320..1375 CDD:238037
AT4G04260NP_001328826.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D168080at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.