DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment polybromo and Cecr2

DIOPT Version :9

Sequence 1:NP_651288.1 Gene:polybromo / 42954 FlyBaseID:FBgn0039227 Length:1654 Species:Drosophila melanogaster
Sequence 2:XP_008761473.1 Gene:Cecr2 / 500308 RGDID:1564182 Length:1465 Species:Rattus norvegicus


Alignment Length:607 Identity:131/607 - (21%)
Similarity:230/607 - (37%) Gaps:150/607 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DLLKVQQKLKTDSYDDLDDLMADLELLIGNAKAFYIPGSSEHQDAVSLWQHIHSQRQRIMEAN-G 158
            ::.:::..|..|..|.:.||:|.|           :.|..:.:|...  |..||..:.|:... .
  Rat    40 EIEELEAALHRDDVDFISDLIACL-----------LQGCYQRRDITP--QTFHSYLEDIINYRWE 91

  Fly   159 LAEEEPRARR--------MSRQVRRMTSSTEPGGDGATDDEYNQYEELFASVMTATDPVGDRLMH 215
            |.|.:|...|        :..:|..:....:...|  .||.::..:.|.|..: ..:|:|:....
  Rat    92 LEEGKPNPLREASFQDLPLRTRVEILHRLCDYRLD--ADDVFDLLKGLDADSL-RVEPLGEDNSG 153

  Fly   216 RMFQLLPSKKIYPDYYDVIEHPIDLRLIATKIQMNAYSSLA-EMERDLLQMTKNACLFNEPGSQI 279
            .::......::|.      |.|:..|       .|...||: |.||.     ||  :.|.||   
  Rat   154 ALYWYFYGTRMYK------EDPVQGR-------SNGELSLSRESERQ-----KN--VSNVPG--- 195

  Fly   280 YKDAKSLKRIFTQRRIELEMGKGKLAKRVKSLSSAAIAALKEEVDSSDDEETSK----------- 333
                |:.||            :|:..||.|         |:||:.||:.:|.:.           
  Rat   196 ----KTGKR------------RGRPPKRKK---------LQEEIISSEKQEENSLTSDLQTRNGS 235

  Fly   334 --KGEGPMWALFDHLYNAPGTSEHPGVTGPPLGNSLWKLPVRRFHPEYFELI----KRPISMSQI 392
              .|:|..|.|..........:|............|:||....|.||...:|    |||   .:.
  Rat   236 RGPGQGTWWLLCQTEEEWRQVTESFRERTSLRERQLYKLLSEDFLPEICNMIAQKGKRP---QRT 297

  Fly   393 HTKLK---KGDYANISDLTADLYLMLDNAKKAFPTSHRTHKDALKMLKLMNAKLVEESLEEGSDL 454
            ..:|:   ..|:.:|.....:...||...:|    ..|..::..:.|.|...|..:|.:     |
  Rat   298 KPELQHRFMSDHLSIKSTKLEETPMLTKIEK----QKRKEEEEERQLLLAVQKKEQEQM-----L 353

  Fly   455 DDEDAEEMDTEVFTVSTQPEKRKPGRPRINSNSNSNASHTPNNSNSPKSNRIAINAAIKK----- 514
            .:|...|::.:|..|..:.::||....|  :...:.....|     |:.:.:.:|:.:::     
  Rat   354 KEERKRELEEKVKAVEDRAKRRKLREER--AWLLAQGKELP-----PELSHLDLNSPMREGKKTK 411

  Fly   515 -------------KILSIQKYLVDYSLGNRRPIEMFMEKPPRKIYPDYYDIIQNPIDMNTIEHNI 566
                         |:|.:.|...|     ..|   |:|.......|:||.||:.|:|::::|..:
  Rat   412 DIFELDDDFTAMYKVLDVVKAHKD-----SWP---FLEPVDESYAPNYYQIIKIPMDISSMEKKL 468

  Fly   567 RTDRYAAVEDVVSDYRLMFSNCRQYNEEGSNIYEDANILERALNEKL-KEFPG----------LT 620
            ....|...|:.|:|.:.||.|||:||.:.|...:.:..|||..:..: |.|||          :.
  Rat   469 NGGLYCTKEEFVNDMKTMFRNCRKYNGDSSEYTKMSENLERCFHRAMTKHFPGEDGDTDEEFWIR 533

  Fly   621 EGKKSQQKYSKVGRKLKTAVIT 642
            |.:|.:::.|:.||...:.|.|
  Rat   534 EDEKREKRRSRAGRSSGSHVWT 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
polybromoNP_651288.1 Bromodomain 46..158 CDD:295360 13/63 (21%)
Bromo_polybromo_II 191..294 CDD:99948 22/103 (21%)
Bromo_polybromo_III 335..443 CDD:99951 24/114 (21%)
Bromo_polybromo_IV 512..613 CDD:99949 30/118 (25%)
Bromo_polybromo_V 641..733 CDD:99946 1/2 (50%)
Bromo_polybromo_VI 758..867 CDD:99956
BAH_polybromo 921..1040 CDD:240068
BAH_polybromo 1120..1234 CDD:240068
HMG-box 1320..1375 CDD:238037
Cecr2XP_008761473.1 WHIM3 244..284 CDD:292248 9/39 (23%)
Bromo_gcn5_like 418..518 CDD:99941 30/107 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.