DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment polybromo and Brd8dc

DIOPT Version :9

Sequence 1:NP_651288.1 Gene:polybromo / 42954 FlyBaseID:FBgn0039227 Length:1654 Species:Drosophila melanogaster
Sequence 2:NP_808441.2 Gene:Brd8dc / 271508 MGIID:3045347 Length:273 Species:Mus musculus


Alignment Length:168 Identity:43/168 - (25%)
Similarity:76/168 - (45%) Gaps:28/168 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 EGSNIYED--ANIL--ERALNEKLKEFPGLTEGKKSQQKYSKVGRKLKTAVITERLWQFYETVKE 654
            ||..:.|.  .|||  ...||:       |::|...|.::          :..:.|.|.::.:..
Mouse   126 EGIRVQEAPLVNILYSSSQLND-------LSQGDPIQDQF----------LFKKTLLQVWKMIAS 173

  Fly   655 YQEPKGKRQLSLIFTKLPSKSEYPDYYDIIREPIDMDRIAQKLKQGAYDTLDDLAADFLLMLENA 719
            :       :.|..|.|..|:.:.|.|.|:::.|:|:..:.:.|.:|...|:.:...|.:||.:||
Mouse   174 H-------RFSSPFLKPVSEKQAPGYKDVVKRPMDLTTLKRNLSKGRIHTMAEFQRDLMLMFQNA 231

  Fly   720 CKYNEPDSQIYKDALVLQQLTLQLKQQLRTERDSLPDV 757
            ..||:.|..||..|:.:|:..|:..|.|.|..|...|:
Mouse   232 VMYNDSDHHIYHMAVEMQREVLEQIQVLSTWLDKRKDL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
polybromoNP_651288.1 Bromodomain 46..158 CDD:295360
Bromo_polybromo_II 191..294 CDD:99948
Bromo_polybromo_III 335..443 CDD:99951
Bromo_polybromo_IV 512..613 CDD:99949 8/22 (36%)
Bromo_polybromo_V 641..733 CDD:99946 24/91 (26%)
Bromo_polybromo_VI 758..867 CDD:99956 43/168 (26%)
BAH_polybromo 921..1040 CDD:240068
BAH_polybromo 1120..1234 CDD:240068
HMG-box 1320..1375 CDD:238037
Brd8dcNP_808441.2 Bromo_brd8_like 160..259 CDD:99939 28/105 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.