DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment polybromo and tbrd-3

DIOPT Version :9

Sequence 1:NP_651288.1 Gene:polybromo / 42954 FlyBaseID:FBgn0039227 Length:1654 Species:Drosophila melanogaster
Sequence 2:NP_726307.1 Gene:tbrd-3 / 246604 FlyBaseID:FBgn0050417 Length:268 Species:Drosophila melanogaster


Alignment Length:177 Identity:45/177 - (25%)
Similarity:69/177 - (38%) Gaps:48/177 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   640 VITERL---------WQFYETVKEYQEPKGKRQLSLIFTKLPSKSEYPDYYDIIREPIDMDRIAQ 695
            ||.:||         |.||       ||...:.|.|           .||::|:|||:|:..:..
  Fly    19 VIIKRLFSSTYKNIAWVFY-------EPLDPQLLGL-----------HDYHEIVREPMDLSTVRH 65

  Fly   696 KLKQGAYDTLDDLAADFLLMLENACKYNEPDSQIYKDALVLQQLTLQLKQQLRTERDSLPDVPLA 760
            :|..|.|.:..|.|.|..|:..|...|..||...|..|..||.:..::..|:             
  Fly    66 RLNTGCYLSAADFAKDIRLIFYNTYLYTNPDHLCYHMAKQLQIIFEEMYSQV------------- 117

  Fly   761 VQELFLTLFTTIYNHQDEEGRCYSDSLAELPEYDEIG---EGPKVRG 804
              :|::....:....::|.....|||.:  || ||:.   ..|.:.|
  Fly   118 --QLYICSSGSKVRAEEESSSDESDSSS--PE-DEVNGSEVSPSIMG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
polybromoNP_651288.1 Bromodomain 46..158 CDD:295360
Bromo_polybromo_II 191..294 CDD:99948
Bromo_polybromo_III 335..443 CDD:99951
Bromo_polybromo_IV 512..613 CDD:99949
Bromo_polybromo_V 641..733 CDD:99946 29/100 (29%)
Bromo_polybromo_VI 758..867 CDD:99956 11/50 (22%)
BAH_polybromo 921..1040 CDD:240068
BAH_polybromo 1120..1234 CDD:240068
HMG-box 1320..1375 CDD:238037
tbrd-3NP_726307.1 Bromo_Brdt_II_like 13..114 CDD:99930 33/112 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.