DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and erf

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_005159421.1 Gene:erf / 560416 ZFINID:ZDB-GENE-010724-17 Length:621 Species:Danio rerio


Alignment Length:155 Identity:56/155 - (36%)
Similarity:79/155 - (50%) Gaps:20/155 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 LQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYE 562
            :|||.|::.||.:.... ..|||.|...||.:.:|:||||.||.:|.:|.||||||||:|||||.
Zfish    27 IQLWHFILELLRKEEYH-DVIAWQGDYGEFVIKDPDEVARLWGARKCKPQMNYDKLSRALRYYYN 90

  Fly   563 KGIMQKVNGERYVYRFVCDPDALFNMAYGHL-TTGSGKGDQHQLTLSLAKT----PPT------S 616
            |.|:.|..|:|:.|:|..:...|.|..:..: :.|||.........|...|    ||:      |
Zfish    91 KRILHKTKGKRFTYKFNFNKLVLVNYPFIDMGSAGSGVPQSAPPVPSGVSTHFRFPPSTPSDVLS 155

  Fly   617 GDSQTQSP--------RVAKSEYYD 633
            ...:.:||        |:|:....|
Zfish   156 PSEELRSPGVFSAVPRRIARGSVSD 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 41/84 (49%)
erfXP_005159421.1 ETS 26..111 CDD:197710 41/84 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.