DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and elk3

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_005164599.1 Gene:elk3 / 557074 ZFINID:ZDB-GENE-030716-2 Length:408 Species:Danio rerio


Alignment Length:136 Identity:58/136 - (42%)
Similarity:84/136 - (61%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 SLQLWQFLV-ALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYY 560
            ::.|||||: .|||:  :....|.||....||||::.||||:.|||:||:..||||||||:||||
Zfish     4 AITLWQFLLQLLLDQ--SHKHLICWTSNDGEFKLLKSEEVAKLWGLRKNKTNMNYDKLSRALRYY 66

  Fly   561 YEKGIMQKVNGERYVYRFVCDPDAL--------FNMAYGHLTTG---------SGKGDQH-QLTL 607
            |:|.|::||.|:::||:||..||.|        .....||:..|         .|:|::. :|:|
Zfish    67 YDKNIIKKVIGQKFVYKFVSFPDILKMDPQAVELGRDGGHVAGGVMLQDVESDCGEGEESPKLSL 131

  Fly   608 SLAKTP 613
            |..::|
Zfish   132 SSLRSP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 46/86 (53%)
elk3XP_005164599.1 ETS 19..89 CDD:197710 38/69 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.