DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and FEV

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_059991.1 Gene:FEV / 54738 HGNCID:18562 Length:238 Species:Homo sapiens


Alignment Length:179 Identity:71/179 - (39%)
Similarity:93/179 - (51%) Gaps:35/179 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 AISQRRGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLS 554
            |:.:..|.:||||||:.||.: ..:|.||||.|...||||.:|:|||||||.:|::|.|||||||
Human    39 AVQKGSGQIQLWQFLLELLAD-RANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLS 102

  Fly   555 RSLRYYYEKGIMQKVNGERYVYRF-------VCDPDALFNMAYGHLTTGSG-------KGDQHQL 605
            |:|||||:|.||.||:|:||.|||       .|.|..    |:.|....:.       .|..::|
Human   103 RALRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQPPP----AHAHAAAAAAAAAAAAQDGALYKL 163

  Fly   606 TLSLAKTP----------------PTSGDSQTQSPRVAKSEYYDTAALH 638
            ...||..|                ..:|.|....|..|.:....||||:
Human   164 PAGLAPLPFPGLSKLNLMAASAGVAPAGFSYWPGPGPAATAAAATAALY 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 53/92 (58%)
FEVNP_059991.1 ETS 46..131 CDD:197710 52/85 (61%)
May mediate active transcriptional repression 129..238 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.