DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and ETV3L

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001004341.1 Gene:ETV3L / 440695 HGNCID:33834 Length:361 Species:Homo sapiens


Alignment Length:170 Identity:57/170 - (33%)
Similarity:78/170 - (45%) Gaps:48/170 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 LQLWQFLVALLDEPTTSASCIAW-TGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYY 561
            :|||.|::.|| :.......||| .|...||.:.:|:||||.||.:|.:|.||||||||:|||||
Human    39 IQLWHFILELL-QKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYY 102

  Fly   562 EKGIMQKVNGERYVYRF-----------------------------VCDP---------DALFNM 588
            .|.|:.|..|:|:.|:|                             :|.|         :.|.:|
Human   103 NKRILHKTKGKRFTYKFNFSKLIVVNYPLWEVRAPPSPHLLLGAPALCRPALVPVGVQSELLHSM 167

  Fly   589 AYGHLTTGSGKGDQHQLT-LSLAKTPP-TSGDSQTQSPRV 626
            .:.|      :....||| ....:.|| ||||.:..|..|
Human   168 LFAH------QAMVEQLTGQQTPRGPPETSGDKKGSSSSV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 43/123 (35%)
ETV3LNP_001004341.1 ETS 38..124 CDD:197710 41/85 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..201 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.