DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and ERFL

DIOPT Version :10

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001352032.1 Gene:ERFL / 390937 HGNCID:53894 Length:354 Species:Homo sapiens


Alignment Length:131 Identity:52/131 - (39%)
Similarity:69/131 - (52%) Gaps:15/131 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 LQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYE 562
            :|||.|::.||.:.... ..|||.|...||.:.:|:||||.||::|.:|.||||||||:|||||.
Human    42 IQLWHFILELLQKEEYQ-GVIAWQGDYGEFVIKDPDEVARLWGIRKCKPHMNYDKLSRALRYYYN 105

  Fly   563 KGIMQKVNGERYVYRFVCDPDALFN---MAYGHLTTGSGKGDQHQLTLSLAKTP-PTSGDSQTQS 623
            |.|:.|..|:|:.|:|......|.|   :......|||          .|..|| |..|.....:
Human   106 KRILHKTKGKRFTYKFNFSKVVLVNYPLLDMAAAATGS----------PLLLTPSPFGGAPGPDA 160

  Fly   624 P 624
            |
Human   161 P 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 41/84 (49%)
ERFLNP_001352032.1 ETS 41..123 CDD:197710 41/81 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..354
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.