DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and fli1rs

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_009290803.1 Gene:fli1rs / 386723 ZFINID:ZDB-GENE-031114-3 Length:496 Species:Danio rerio


Alignment Length:255 Identity:82/255 - (32%)
Similarity:124/255 - (48%) Gaps:47/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 SSSAVYATP--SHYAHQQQTQSQSVYRDLSPTTLAAVSDADLKYDSGPYNA--AISS--TYPSAL 456
            |||.:.|.|  |...||..|:               :::...:....||.|  :|||  ..|.|.
Zfish   248 SSSGLPAVPKGSPIEHQHNTR---------------ITEPPPRLPQDPYQALGSISSRLANPEAK 297

  Fly   457 RPNVVDSTTSSDAELRLDQFYASNGISTSSNGQAISQRRGSLQLWQFLVALLDEPTTSASCIAWT 521
            ..:..:.||..:          |:.:..||..:.:..  |.:||||||:.||.: :.:::.|.|.
Zfish   298 PIHTKNRTTKQN----------SSHLPVSSTDRTVGS--GQIQLWQFLLELLSD-SNNSTIITWE 349

  Fly   522 GRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCDPDALF 586
            |...|||:.:|:|||:|||.:|::|.||||||||:|||||:|.||.||:|:||.|:|  |...:.
Zfish   350 GTNGEFKMTDPDEVAKRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF--DFQGIS 412

  Fly   587 NMAYGHLTTGS-----GKGD------QHQLTLSLAKTPPTSGDSQTQSPRVAKSEYYDTA 635
            .....|.|.||     .:|.      .||..::......|.....|.:....:|.|:::|
Zfish   413 QSHQNHSTEGSVYKFQTEGSYMQSYHSHQPKMNFISPHSTPMSVTTSNFFTPQSTYWNSA 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 47/85 (55%)
fli1rsXP_009290803.1 SAM_superfamily 127..216 CDD:301707
ETS 326..409 CDD:197710 47/85 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.