DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and Etv2

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_038949886.1 Gene:Etv2 / 361544 RGDID:1310603 Length:368 Species:Rattus norvegicus


Alignment Length:180 Identity:68/180 - (37%)
Similarity:90/180 - (50%) Gaps:33/180 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 AAVSDADLKYDSGPYNAAI---SSTYPSALRPNVVDSTTSSDAELRLDQFYASNGISTSSNGQAI 491
            :|.||....::||..|.:|   ....|:...|:  .|:..|| ...|..:..:|           
  Rat   212 SAGSDYTTTWNSGLQNCSIPFEGHQIPAFATPS--KSSQQSD-RATLTPYSKTN----------- 262

  Fly   492 SQRRGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRS 556
              .||.:||||||:.||.:...| |||.|||...||:|.:|:||||.||.:|.:|.|||:||||.
  Rat   263 --HRGPIQLWQFLLELLHDGARS-SCIRWTGNNREFQLCDPKEVARLWGERKRKPGMNYEKLSRG 324

  Fly   557 LRYYYEKGIMQKVNGERYVYRF-------VCDPDALFNMAYGHLTTGSGK 599
            |||||.:.|:.|..|.:|.|||       .|..|      .|||....|:
  Rat   325 LRYYYRRDIVLKSGGRKYTYRFGGRVPVLACQDD------MGHLPGAEGQ 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 47/92 (51%)
Etv2XP_038949886.1 ETS 266..348 CDD:197710 46/82 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.