DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and Ets21C

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001285547.1 Gene:Ets21C / 33229 FlyBaseID:FBgn0005660 Length:475 Species:Drosophila melanogaster


Alignment Length:322 Identity:90/322 - (27%)
Similarity:135/322 - (41%) Gaps:116/322 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 ASAFKFSHT-----AVISSSAV--------------YATPSHYAHQQQTQSQSVYRDLSPTTLAA 431
            :||..:|.|     :..|||::              .|||:..|.....|:.|..|:.|.:. .:
  Fly    77 SSASSYSSTDSDSGSSTSSSSIRSQLPALNLPVPLPLATPTPPAVSSPHQAPSPRRNSSDSN-RS 140

  Fly   432 VSDADLKYDSGPYNAAISSTYPSALRPNVVDSTT-------SSDAELRLDQF------------- 476
            ||..::..|            |.|..|..:.|..       ..|.|..:|:|             
  Fly   141 VSPVEVPVD------------PHAWTPEDIASWVRWATRKFKLDPEPDIDRFPKDAQELCDLSRA 193

  Fly   477 -----------------------YASNGISTS----------------SNGQAISQ-RRGSLQLW 501
                                   |.:.|..||                ::.:.::| ..|.:|||
  Fly   194 DFWVCAGSRRGGMLLAQHFAISLYHATGRETSPMLNDDEPNPYQLLNAASHRLVAQGSGGQIQLW 258

  Fly   502 QFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIM 566
            |||:.||.: :::|:.|:|.|:..||:||:|:|||||||.:|.:|.||||||||:|||||:|.||
  Fly   259 QFLLELLAD-SSNANAISWEGQSGEFRLIDPDEVARRWGERKAKPNMNYDKLSRALRYYYDKNIM 322

  Fly   567 QKVNGERYVYRF-------VC-------DPDALFNMAYGHLTTGSGKGDQHQLTLSLAKTPP 614
            .||:|:||.|:|       .|       ||.:....:|.|...|:         :.|.:.||
  Fly   323 TKVHGKRYAYKFDFHGLMAACQAQAQGGDPASSMLGSYNHHAGGA---------MQLGRHPP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 51/99 (52%)
Ets21CNP_001285547.1 SAM_PNT 149..217 CDD:188876 9/79 (11%)
ETS 254..339 CDD:197710 49/85 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450433
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.