DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and ets2

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001018874.1 Gene:ets2 / 326672 ZFINID:ZDB-GENE-050522-552 Length:439 Species:Danio rerio


Alignment Length:322 Identity:92/322 - (28%)
Similarity:126/322 - (39%) Gaps:100/322 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 PHPHPYCYR--FPSSPPAGILKKSDEEATSAAVYCSDVSSGQHFPHHTKIEHADSTTTAAQQQQQ 328
            |:||....|  |.:|..|.:|..:.|....|....|.||  ..:..|...::.....||....:|
Zfish   188 PNPHSSLLRELFQTSDDAALLASAAELPACAKPQLSTVS--VRYRSHEFTKNTPQLRTAGSSGEQ 250

  Fly   329 QQEQQQQQQQQQQQQQHQQQLQQAAALHPHHHHSHHGHHGHQQAEQQALTHLTPL----HAASAF 389
            ..::..:..::             ..|.....||.........:.......|.||    |..| |
Zfish   251 ASQESVESAEE-------------CVLRSWGSHSSLADTQRVPSYDSFEEELLPLGLQKHGRS-F 301

  Fly   390 KFSHTAVISSSAVYATPSHYAHQQQTQSQSVYRDLSPTTLAAVSDADLKYDSGPYNAAISSTYPS 454
            |                 .|. |::.|:|...|.:.|..:.|                       
Zfish   302 K-----------------DYV-QERNQTQETGRPVIPAAVLA----------------------- 325

  Fly   455 ALRPNVVDSTTSSDAELRLDQFYASNGISTSSNGQAISQRRGSLQLWQFLVALLDEPTTSASCIA 519
                                      |.:.|          |.:||||||:.||.: :|..|.|:
Zfish   326 --------------------------GFTGS----------GPIQLWQFLLELLTD-STCQSIIS 353

  Fly   520 WTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCD 581
            |||.|.||||.:|:|||||||.:||:|.|||:||||.|||||:|.|:.|.:|:|||||||||
Zfish   354 WTGDGWEFKLTDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 55/85 (65%)
ets2NP_001018874.1 SAM_superfamily 76..164 CDD:301707
ETS 332..416 CDD:197710 55/85 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.