DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and Elk1

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001101529.1 Gene:Elk1 / 314436 RGDID:1598663 Length:427 Species:Rattus norvegicus


Alignment Length:137 Identity:62/137 - (45%)
Similarity:85/137 - (62%) Gaps:11/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 SLQLWQFLVALLDEPTTSASCIAWTGR-GMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYY 560
            |:.|||||:.||.| ..:...|:||.| |.||||::.|||||.|||:||:..||||||||:||||
  Rat     4 SVTLWQFLLQLLRE-QGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYY 67

  Fly   561 YEKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTTGSGKGDQHQLTLSLAKTPPT----SGDSQT 621
            |:|.|::||:|:::||:||..|:..     |..|.......:..:|.::|..|.|    .||:.|
  Rat    68 YDKNIIRKVSGQKFVYKFVSYPEVA-----GCSTEDCPPQPEVSVTSAVAMAPATVHSGPGDNAT 127

  Fly   622 QSPRVAK 628
            ..|...|
  Rat   128 GKPGTPK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 50/86 (58%)
Elk1NP_001101529.1 ETS 4..89 CDD:197710 50/85 (59%)
PHA03247 <100..427 CDD:223021 9/35 (26%)
PHA03132 112..>246 CDD:222997 8/23 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..146 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..202
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..252
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..350
Sufficient for interaction with MAD2L2. /evidence=ECO:0000250|UniProtKB:P19419 348..398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X7531
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.