DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and Elk1

DIOPT Version :10

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001101529.1 Gene:Elk1 / 314436 RGDID:1598663 Length:427 Species:Rattus norvegicus


Alignment Length:137 Identity:62/137 - (45%)
Similarity:85/137 - (62%) Gaps:11/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 SLQLWQFLVALLDEPTTSASCIAWTGR-GMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYY 560
            |:.|||||:.||.| ..:...|:||.| |.||||::.|||||.|||:||:..||||||||:||||
  Rat     4 SVTLWQFLLQLLRE-QGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYY 67

  Fly   561 YEKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTTGSGKGDQHQLTLSLAKTPPT----SGDSQT 621
            |:|.|::||:|:::||:||..|:..     |..|.......:..:|.::|..|.|    .||:.|
  Rat    68 YDKNIIRKVSGQKFVYKFVSYPEVA-----GCSTEDCPPQPEVSVTSAVAMAPATVHSGPGDNAT 127

  Fly   622 QSPRVAK 628
            ..|...|
  Rat   128 GKPGTPK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 50/86 (58%)
Elk1NP_001101529.1 ETS 4..89 CDD:197710 50/85 (59%)
PHA03247 <100..427 CDD:223021 9/35 (26%)
PHA03132 112..>246 CDD:222997 8/23 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..146 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..202
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..252
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..350
Sufficient for interaction with MAD2L2. /evidence=ECO:0000250|UniProtKB:P19419 348..398
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.