DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and Elk4

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_008767689.1 Gene:Elk4 / 304786 RGDID:1310504 Length:437 Species:Rattus norvegicus


Alignment Length:140 Identity:62/140 - (44%)
Similarity:84/140 - (60%) Gaps:7/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 SLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYY 561
            ::.|||||:.||.|| .:...|.||....||||::.|||||.||::||:|.||||||||:|||||
  Rat    11 AITLWQFLLQLLQEP-QNEHVICWTSNNGEFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYY 74

  Fly   562 EKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTTGSGKGD---QHQLTLSLAKTPPTSGDSQTQS 623
            .|.|::||||:::||:||..|:.|   ....||.|..:||   .:.:..|.:|.....|..:...
  Rat    75 VKNIIKKVNGQKFVYKFVSYPEIL---KMDPLTVGRIEGDCETLNSIEASSSKDAECGGKERPPQ 136

  Fly   624 PRVAKSEYYD 633
            |....|...|
  Rat   137 PGAKTSSRND 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 49/85 (58%)
Elk4XP_008767689.1 ETS 24..95 CDD:197710 42/71 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.