DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and Etv3

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001076787.1 Gene:Etv3 / 27049 MGIID:1350926 Length:513 Species:Mus musculus


Alignment Length:168 Identity:57/168 - (33%)
Similarity:79/168 - (47%) Gaps:32/168 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 LQLWQFLVALLDEPTTSASCIAW-TGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYY 561
            :|||.|::.|| :.......||| .|...||.:.:|:||||.||.:|.:|.||||||||:|||||
Mouse    35 IQLWHFILELL-QKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYY 98

  Fly   562 EKGIMQKVNGERYVYRFVCD-------------------------PDALFNMAYGHLTTGSGKGD 601
            .|.|:.|..|:|:.|:|..:                         |.|.....:..|.:.|..||
Mouse    99 NKRILHKTKGKRFTYKFNFNKLVMPNYPFINIRSSGVVPQSAPPVPTASSRFHFPPLDSHSPTGD 163

  Fly   602 QHQ---LTLSLAKTPPTSGDSQTQSPRVAKSEYYDTAA 636
            ...   ...||:.:.|.||  .|...:|..|:..|.:|
Mouse   164 VQPGRFSASSLSASGPESG--VTTDRKVEPSDLEDGSA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 41/110 (37%)
Etv3NP_001076787.1 ETS 34..120 CDD:197710 41/85 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..202 16/64 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.