DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and GABPA

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001184226.1 Gene:GABPA / 2551 HGNCID:4071 Length:454 Species:Homo sapiens


Alignment Length:152 Identity:61/152 - (40%)
Similarity:92/152 - (60%) Gaps:15/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 AAISSTYPSALRPNVVDSTTSSDAELRLDQF----YASNGISTSSNGQAISQRRGSLQLWQFLVA 506
            |::.|..|:.::  |::|:..:....|..:.    .:|.|..|.:|||        :||||||:.
Human   274 ASVQSATPTTIK--VINSSAKAAKVQRAPRISGEDRSSPGNRTGNNGQ--------IQLWQFLLE 328

  Fly   507 LLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNG 571
            ||.: ..:..||:|.|...||||.:||.||::||.:||:|.|||:||||:|||||:..::.||.|
Human   329 LLTD-KDARDCISWVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQG 392

  Fly   572 ERYVYRFVCDPDALFNMAYGHL 593
            :|:||:||||...|...:...|
Human   393 KRFVYKFVCDLKTLIGYSAAEL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 47/85 (55%)
GABPANP_001184226.1 GABP-alpha 40..119 CDD:402975
SAM_PNT-GABP-alpha 168..254 CDD:176084
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..316 4/18 (22%)
ETS 319..403 CDD:197710 47/92 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.