DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and Ets1

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_017450940.1 Gene:Ets1 / 24356 RGDID:2583 Length:529 Species:Rattus norvegicus


Alignment Length:183 Identity:78/183 - (42%)
Similarity:97/183 - (53%) Gaps:37/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 QQTQSQSVYRDLS--PTTLAAVSDADLKYDSGPYNAAISSTYPSALRPNVVDSTTSSD-----AE 470
            |...|||.:..|.  |:                |::..|..||:|| ||.....|..|     |:
  Rat   354 QSWSSQSSFNSLQRVPS----------------YDSFDSEDYPAAL-PNHKPKGTFKDYVRDRAD 401

  Fly   471 LRLDQFYASNGISTSSNGQAISQRRGSLQLWQFLVALLDEPTTSASC---IAWTGRGMEFKLIEP 532
            |..|:............|.      |.:||||||:.||    |..||   |:|||.|.||||.:|
  Rat   402 LNKDKPVIPAAALAGYTGS------GPIQLWQFLLELL----TDKSCQSFISWTGDGWEFKLSDP 456

  Fly   533 EEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCDPDAL 585
            :|||||||.:||:|.|||:||||.|||||:|.|:.|..|:|||||||||..:|
  Rat   457 DEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 56/88 (64%)
Ets1XP_017450940.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.