DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and Ets1

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001359463.1 Gene:Ets1 / 23871 MGIID:95455 Length:484 Species:Mus musculus


Alignment Length:181 Identity:79/181 - (43%)
Similarity:95/181 - (52%) Gaps:33/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 QQTQSQSVYRDLSPTTLAAVSDADLKYDSGPYNAAISSTYPSALRPNVVDSTTSSD-----AELR 472
            |...|||.:..|....         .|||..|     ..||:|| ||.....|..|     |:|.
Mouse   310 QSWSSQSSFNSLQRVP---------SYDSFDY-----EDYPAAL-PNHKPKGTFKDYVRDRADLN 359

  Fly   473 LDQFYASNGISTSSNGQAISQRRGSLQLWQFLVALLDEPTTSASC---IAWTGRGMEFKLIEPEE 534
            .|:............|.      |.:||||||:.||    |..||   |:|||.|.||||.:|:|
Mouse   360 KDKPVIPAAALAGYTGS------GPIQLWQFLLELL----TDKSCQSFISWTGDGWEFKLSDPDE 414

  Fly   535 VARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCDPDAL 585
            ||||||.:||:|.|||:||||.|||||:|.|:.|..|:|||||||||..:|
Mouse   415 VARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 56/88 (64%)
Ets1NP_001359463.1 SAM_PNT-ETS-1 95..182 CDD:176092
ETS 378..462 CDD:197710 55/87 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.