DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and Erfl

DIOPT Version :10

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001357733.1 Gene:Erfl / 232974 MGIID:3642958 Length:352 Species:Mus musculus


Alignment Length:131 Identity:52/131 - (39%)
Similarity:70/131 - (53%) Gaps:15/131 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 LQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYE 562
            :|||.|::.||.:.... ..|||.|...||.:.:|:||||.||::|.:|.||||||||:|||||.
Mouse    42 IQLWHFILELLQKEEYQ-GVIAWQGDYGEFVIKDPDEVARLWGIRKCKPHMNYDKLSRALRYYYN 105

  Fly   563 KGIMQKVNGERYVYRFVCDPDALFN---MAYGHLTTGSGKGDQHQLTLSLAKTP-PTSGDSQTQS 623
            |.|:.|..|:|:.|:|......|.|   :......|||          .|..|| |.:|.....:
Mouse   106 KRILHKTKGKRFTYKFNFSKVVLVNYPLLDVAAAATGS----------PLLLTPGPFAGAPGPDA 160

  Fly   624 P 624
            |
Mouse   161 P 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 41/84 (49%)
ErflNP_001357733.1 ETS 41..123 CDD:197710 41/81 (51%)

Return to query results.
Submit another query.