DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and ETV3

DIOPT Version :10

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001138784.1 Gene:ETV3 / 2117 HGNCID:3492 Length:512 Species:Homo sapiens


Alignment Length:82 Identity:41/82 - (50%)
Similarity:55/82 - (67%) Gaps:2/82 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 LQLWQFLVALLDEPTTSASCIAW-TGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYY 561
            :|||.|::.|| :.......||| .|...||.:.:|:||||.||.:|.:|.||||||||:|||||
Human    35 IQLWHFILELL-QKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYY 98

  Fly   562 EKGIMQKVNGERYVYRF 578
            .|.|:.|..|:|:.|:|
Human    99 NKRILHKTKGKRFTYKF 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 41/82 (50%)
ETV3NP_001138784.1 ETS 34..120 CDD:197710 41/82 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..222
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..512
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.