Sequence 1: | NP_996290.1 | Gene: | Ets96B / 42952 | FlyBaseID: | FBgn0039225 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001243224.1 | Gene: | ETS2 / 2114 | HGNCID: | 3489 | Length: | 609 | Species: | Homo sapiens |
Alignment Length: | 315 | Identity: | 92/315 - (29%) |
---|---|---|---|
Similarity: | 137/315 - (43%) | Gaps: | 92/315 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 326 QQQQQEQQQQQQQQQQQQQHQQQLQQAAALHPHHHHSHHGHHGHQQAEQQALTHLTPLHAASAFK 390
Fly 391 FSHTAVISSSAVYATPSHYAHQQQTQSQSVYRDLSPTTLAAVSDADLKYDSGPYNAAISSTYP-S 454
Fly 455 ALRPNVVDSTTSSD---AELRLDQFYASNGISTSSNGQA-------------------------- 490
Fly 491 --------ISQR---------------------RGSLQLWQFLVALLDEPTTSASCIAWTGRGME 526
Fly 527 FKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCD 581 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ets96B | NP_996290.1 | ETS | 497..583 | CDD:197710 | 54/85 (64%) |
ETS2 | NP_001243224.1 | GSK-3_bind | <39..>143 | CDD:283100 | |
SAM_PNT-ETS-2 | 225..313 | CDD:188884 | 3/8 (38%) | ||
ETS | 502..586 | CDD:197710 | 54/85 (64%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D243757at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |