DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and ERG

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001129626.1 Gene:ERG / 2078 HGNCID:3446 Length:486 Species:Homo sapiens


Alignment Length:281 Identity:84/281 - (29%)
Similarity:124/281 - (44%) Gaps:90/281 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 HSHHGHHGHQQAEQQALTHLTP-------------LHA----ASAFKFSHTAVISSSAVYATPSH 408
            |.|:       ..:..|.|||.             :||    .:||.|.:|              
Human   198 HLHY-------LRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNT-------------- 241

  Fly   409 YAHQQQTQSQSVYRDLSPTTLAAVSDADLKYDSGPYNAAISSTYPS----ALRPNVVDSTTSSDA 469
                      |||.:   .|....:..||.|:....:|.....:|:    |.:|:......:.|.
Human   242 ----------SVYPE---ATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQ 293

  Fly   470 ELRLDQFY----ASNGISTSSNGQAISQRRGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLI 530
            ..:||.:.    .|:.::...:||        :||||||:.||.: ::::|||.|.|...|||:.
Human   294 RPQLDPYQILGPTSSRLANPGSGQ--------IQLWQFLLELLSD-SSNSSCITWEGTNGEFKMT 349

  Fly   531 EPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTT 595
            :|:|||||||.:|::|.||||||||:|||||:|.||.||:|:||.|:|                 
Human   350 DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF----------------- 397

  Fly   596 GSGKGDQHQLTLSLAKTPPTS 616
                 |.|.:..:|...||.|
Human   398 -----DFHGIAQALQPHPPES 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 49/85 (58%)
ERGNP_001129626.1 SAM_PNT-ERG 134..208 CDD:176090 2/16 (13%)
ETS 317..400 CDD:197710 51/113 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.