DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and ELK4

DIOPT Version :10

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001964.2 Gene:ELK4 / 2005 HGNCID:3326 Length:431 Species:Homo sapiens


Alignment Length:154 Identity:63/154 - (40%)
Similarity:88/154 - (57%) Gaps:16/154 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 SLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYY 561
            ::.|||||:.||.:| .:...|.||....:|||::.|||||.||::||:|.||||||||:|||||
Human     4 AITLWQFLLQLLQKP-QNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYY 67

  Fly   562 EKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTTGSGKGDQHQLTLSLAKT------------PP 614
            .|.|::||||:::||:||..|:.| ||  ..:|.|..:||...|..|...:            ||
Human    68 VKNIIKKVNGQKFVYKFVSYPEIL-NM--DPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPP 129

  Fly   615 TSGDSQTQSPRVAKSEYYDTAALH 638
            ..|...:.......|..|.:..|:
Human   130 QPGAKTSSRNDYIHSGLYSSFTLN 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 47/85 (55%)
ELK4NP_001964.2 ETS 17..88 CDD:197710 40/71 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..139 3/24 (13%)
PHA03247 <167..350 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..282
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..323
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..431
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.