DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and ELK3

DIOPT Version :10

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_005221.2 Gene:ELK3 / 2004 HGNCID:3325 Length:407 Species:Homo sapiens


Alignment Length:142 Identity:58/142 - (40%)
Similarity:82/142 - (57%) Gaps:17/142 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 SLQLWQFLV-ALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYY 560
            ::.|||||: .|||:......|  ||....||||::.||||:.|||:||:..||||||||:||||
Human     4 AITLWQFLLQLLLDQKHEHLIC--WTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYY 66

  Fly   561 YEKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTTGSGKGDQHQLTLSLAKTPPTSGDSQTQSPR 625
            |:|.|::||.|:::||:||..|:.|             |.|.|.:.:|.........|.:. ||.
Human    67 YDKNIIKKVIGQKFVYKFVSFPEIL-------------KMDPHAVEISRESLLLQDSDCKA-SPE 117

  Fly   626 VAKSEYYDTAAL 637
            ..::..:..|||
Human   118 GREAHKHGLAAL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 46/86 (53%)
ELK3NP_005221.2 ETS 19..88 CDD:197710 38/70 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..253
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..298
CTBP-binding motif 273..277
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.