DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and ELK1

DIOPT Version :10

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_005220.2 Gene:ELK1 / 2002 HGNCID:3321 Length:428 Species:Homo sapiens


Alignment Length:138 Identity:59/138 - (42%)
Similarity:84/138 - (60%) Gaps:12/138 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 SLQLWQFLVALLDEPTTSASCIAWTGR-GMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYY 560
            |:.|||||:.||.| ..:...|:||.| |.||||::.|||||.|||:||:..||||||||:||||
Human     4 SVTLWQFLLQLLRE-QGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYY 67

  Fly   561 YEKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTTGSGKGDQHQLTLSLAKTPPTS-----GDSQ 620
            |:|.|::||:|:::||:||..|:..     |..|.......:..:|.::....|.:     ||:.
Human    68 YDKNIIRKVSGQKFVYKFVSYPEVA-----GCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTV 127

  Fly   621 TQSPRVAK 628
            :..|...|
Human   128 SGKPGTPK 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 50/86 (58%)
ELK1NP_005220.2 ETS 4..89 CDD:197710 50/85 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..149 4/15 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..205
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..358
Sufficient for interaction with MAD2L2. /evidence=ECO:0000269|PubMed:17296730 349..399
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.