Sequence 1: | NP_996290.1 | Gene: | Ets96B / 42952 | FlyBaseID: | FBgn0039225 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001362039.1 | Gene: | elk-2 / 190623 | WormBaseID: | WBGene00022207 | Length: | 244 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 47/203 - (23%) |
---|---|---|---|
Similarity: | 65/203 - (32%) | Gaps: | 62/203 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 PNTSTITTDSVVSCVSSTLPAVAKAISASSSCDGLQSERKKCPISDLDSGGHGHGQGHGLMEAIC 122
Fly 123 AGQKTSP--IPPPPPPCCLTLGESSSSPNPIATAALMNASTSGSSSAGGASASLCNDLTRESSWY 185
Fly 186 AHHHHHHHHHHHQLPDELVMYATPTPTPAIGKFGLDTSTEGYLNARYNVNVKGVRHDRTSSFFDI 250
Fly 251 PAVTHPHN 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ets96B | NP_996290.1 | ETS | 497..583 | CDD:197710 | |
elk-2 | NP_001362039.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3806 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |