DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and elk-2

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001362039.1 Gene:elk-2 / 190623 WormBaseID:WBGene00022207 Length:244 Species:Caenorhabditis elegans


Alignment Length:203 Identity:47/203 - (23%)
Similarity:65/203 - (32%) Gaps:62/203 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PNTSTITTDSVVSCVSSTLPAVAKAISASSSCDGLQSERKKCPISDLDSGGHGHGQGHGLMEAIC 122
            |.|.:::|.|....|.|  |:.:.|.||:.|......|.::|....|.|                
 Worm    54 PTTHSVSTPSPTDSVCS--PSSSVASSATPSTSSPVDESRQCRKRSLSS---------------- 100

  Fly   123 AGQKTSP--IPPPPPPCCLTLGESSSSPNPIATAALMNASTSGSSSAGGASASLCNDLTRESSWY 185
               .|:|  ..||.||.     :....|||:...|..|.|...|.|:             .....
 Worm   101 ---STTPSTTAPPQPPT-----KKGMKPNPLNLTATSNFSLQPSISS-------------PLLML 144

  Fly   186 AHHHHHHHHHHHQLPDELVMYATPTPTPAIGKFGLDTSTEGYLNARYNVNVKGVRHDRTSSFFDI 250
            ..||.:......|: .:|..||      |:...||           |...:.  .|..:.|.|..
 Worm   145 QQHHQNSPLFQAQI-SQLYTYA------ALASAGL-----------YGPQIS--PHLASQSPFRS 189

  Fly   251 PAVTHPHN 258
            |.|| |.|
 Worm   190 PLVT-PKN 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710
elk-2NP_001362039.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.