DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and ets-7

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_504947.2 Gene:ets-7 / 184687 WormBaseID:WBGene00017601 Length:218 Species:Caenorhabditis elegans


Alignment Length:171 Identity:52/171 - (30%)
Similarity:76/171 - (44%) Gaps:48/171 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 TSSNGQAISQRRGSLQLWQFLVALLDEPTTSASCIAWTGRG-MEFKLIEPEEVARRWGLQKNRPA 547
            ||.||:   ||     |..||..||::.:.| ..|.|:.:. :||::::|.:||..||.....|.
 Worm     6 TSPNGK---QR-----LLNFLRGLLEDDSHS-DLITWSNKDTLEFQMLKPHKVAELWGAATGNPG 61

  Fly   548 MNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCDP------------------DALFN----MAY 590
            |||||:||.|||:|....::||.|:...|.|:..|                  ..||:    :|.
 Worm    62 MNYDKMSRGLRYFYTNNTLKKVKGKDSRYCFLDTPLLAPFPDFFPKANEPMRRVPLFSIENLLAS 126

  Fly   591 GHLTTGSGKGDQHQLTLSLAKTPPTSGDSQ-------TQSP 624
            ...||.:         .||..:|.:|.:|.       |.||
 Worm   127 SEETTSN---------FSLQSSPSSSSNSSSARTMSATSSP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 33/104 (32%)
ets-7NP_504947.2 Ets 14..93 CDD:365925 31/79 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.