DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and F19F10.1

DIOPT Version :10

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_504949.2 Gene:F19F10.1 / 184684 WormBaseID:WBGene00017598 Length:210 Species:Caenorhabditis elegans


Alignment Length:98 Identity:23/98 - (23%)
Similarity:39/98 - (39%) Gaps:17/98 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TQFFKLAEEKTNVPRLYIFLGGVAVVILYLAFGYGAQI-LCNVIGVAYPAYISMKAIETRTKEDD 87
            :.|||......|.      |.|:.::.:..:...|..: |..::.:|..|:.:...| |:....|
 Worm    16 SSFFKTCFNALNA------LSGIGILSVPYSLARGGWLSLSLLLLLAVTAFYTSLLI-TKCMNAD 73

  Fly    88 TKWLTY----WVTFG-----VLSVFEHFSFFLV 111
            ....||    ...||     ::|||.|...:||
 Worm    74 RNIKTYPDIGERAFGRPGRIIVSVFMHLELYLV 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710
F19F10.1NP_504949.2 ETS 11..97 CDD:197710 17/87 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.