DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and ets-8

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_500046.2 Gene:ets-8 / 183631 WormBaseID:WBGene00016798 Length:141 Species:Caenorhabditis elegans


Alignment Length:96 Identity:34/96 - (35%)
Similarity:61/96 - (63%) Gaps:2/96 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 NGQAISQRRGSLQLWQFLVALLDEPTTSASCIAWTGR-GMEFKLIEPEEVARRWGLQKNRPAMNY 550
            |.::.|.::....|:|.::...::... |..|.||.: .:||::::.:||||.||.:|....|:|
 Worm    19 NPRSTSHKKLRNYLFQMILKSENDKNV-AKIIKWTKKSSLEFQMVDRQEVARLWGAEKGNLKMDY 82

  Fly   551 DKLSRSLRYYYEKGIMQKVNGERYVYRFVCD 581
            :.||||:|.||:.|||:|:.|:.:.|:|:.|
 Worm    83 EFLSRSIRSYYKSGIMRKIPGKDFRYQFIAD 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 32/86 (37%)
ets-8NP_500046.2 ETS 25..115 CDD:197710 32/90 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11849
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.