DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and ets-9

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001371009.1 Gene:ets-9 / 180702 WormBaseID:WBGene00016865 Length:225 Species:Caenorhabditis elegans


Alignment Length:209 Identity:56/209 - (26%)
Similarity:86/209 - (41%) Gaps:74/209 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 HYAHQQQTQSQSVYRDLSPTTLAAVSDADLKYDSGPYNAAIS---------------STYPSALR 457
            ::.|..:|     |.|:||.|              |.|:.|.               .::|::|.
 Worm    18 NFTHDVRT-----YPDISPPT--------------PTNSHIRCWAQFSIAQQLPCAVPSFPTSLF 63

  Fly   458 P-NVVDSTTSSDAELRLDQFYASNGISTSSNGQAISQRRGSLQLWQFLVAL-LDEPTTSASCIAW 520
            | .:::....:|.||                    .:.:|..:|..|||.| ::|....|  :.|
 Worm    64 PLPIMNDEPMTDDEL--------------------VKMKGPSRLIGFLVHLAMNERARKA--LRW 106

  Fly   521 TGRGMEFKLIEPEEVARRWGLQK-NRPAMNYDKLSRSLRYYYEK----------GIMQKVNGER- 573
            ||.|:||.|:..|.||:.||.:| |...|:|.||||::|..|||          |.::|  |.| 
 Worm   107 TGNGLEFVLVNKELVAKMWGNRKHNTKDMDYYKLSRAIREKYEKKDKADKNIKPGKLKK--GTRT 169

  Fly   574 --YVYRFVCDPDAL 585
              ||:.....||.:
 Worm   170 YSYVFTEHAYPDLM 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 37/100 (37%)
ets-9NP_001371009.1 Ets 86..>150 CDD:413392 29/65 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.