DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and Etv2

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_006539604.1 Gene:Etv2 / 14008 MGIID:99253 Length:358 Species:Mus musculus


Alignment Length:195 Identity:71/195 - (36%)
Similarity:95/195 - (48%) Gaps:32/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 AHQQQTQS--QSVYRDLSPTTLAAVSDADLKYDSGPYNAAISSTYPSALRPNVVDSTTSSDAELR 472
            ||:....|  .|...|.:.|....:.|..:.:: |..:.|.  |.||       .|...|| ...
Mouse   191 AHEDYKMSWGGSAGSDYTTTWNTGLQDCSIPFE-GHQSPAF--TTPS-------KSNKQSD-RAT 244

  Fly   473 LDQFYASNGISTSSNGQAISQRRGSLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVAR 537
            |.::..:|             .||.:||||||:.||.:...| |||.|||...||:|.:|:||||
Mouse   245 LTRYSKTN-------------HRGPIQLWQFLLELLHDGARS-SCIRWTGNSREFQLCDPKEVAR 295

  Fly   538 RWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRF---VCDPDALFNMAYGHLTTGSGK 599
            .||.:|.:|.|||:||||.|||||.:.|:.|..|.:|.|||   |  |...:....|||....|:
Mouse   296 LWGERKRKPGMNYEKLSRGLRYYYRRDIVLKSGGRKYTYRFGGRV--PVLAYQDDMGHLPGAEGQ 358

  Fly   600  599
            Mouse   359  358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 47/88 (53%)
Etv2XP_006539604.1 ETS 256..338 CDD:197710 46/82 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.