DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and elk1

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_002941754.3 Gene:elk1 / 100497609 XenbaseID:XB-GENE-5992134 Length:555 Species:Xenopus tropicalis


Alignment Length:152 Identity:65/152 - (42%)
Similarity:93/152 - (61%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 STSSNGQAISQRRGSLQ-----LWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQ 542
            |.:..|:|:|..|..:.     |||||:.||:| .:....|:||....||||::.|||||.|||:
 Frog   131 SGNQEGRALSSLRSPVMDPSGTLWQFLLQLLEE-QSHRHLISWTSNDGEFKLLDAEEVARLWGLR 194

  Fly   543 KNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTTGSGKGDQHQLTL 607
            ||:..||||||||:|||||:|.|::||:|:::||:|||.||.      |:.......|...: ::
 Frog   195 KNKTNMNYDKLSRALRYYYDKNIIKKVSGQKFVYKFVCYPDP------GNSEVSKDDGKCRE-SV 252

  Fly   608 SLAKTPPTSGDSQTQSPRVAKS 629
            |....||.|.||....|::.:|
 Frog   253 SEPSQPPKSADSSPFVPKMVRS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 48/90 (53%)
elk1XP_002941754.3 ETS 152..235 CDD:197710 48/83 (58%)
PRK13709 <315..432 CDD:237478
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7531
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.