DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and elk4

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_002933036.1 Gene:elk4 / 100491321 XenbaseID:XB-GENE-490642 Length:408 Species:Xenopus tropicalis


Alignment Length:105 Identity:56/105 - (53%)
Similarity:75/105 - (71%) Gaps:4/105 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   497 SLQLWQFLVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYY 561
            ::.|||||:.||.||..: ..|.||....||||::.|||||.||::||:|:||||||||:|||||
 Frog     4 AITLWQFLLQLLQEPHHN-QLICWTSNDGEFKLLQAEEVARLWGVRKNKPSMNYDKLSRALRYYY 67

  Fly   562 EKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTTGSGKGD 601
            .|.|::||||:::||:||..||.|   ....||...|:|:
 Frog    68 VKNIIKKVNGQKFVYKFVSYPDIL---TMDPLTLARGEGE 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 49/85 (58%)
elk4XP_002933036.1 ETS 17..89 CDD:197710 42/72 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.