DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets96B and ets1

DIOPT Version :9

Sequence 1:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001123840.1 Gene:ets1 / 100170599 XenbaseID:XB-GENE-6465484 Length:438 Species:Xenopus tropicalis


Alignment Length:192 Identity:82/192 - (42%)
Similarity:101/192 - (52%) Gaps:40/192 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 SHYAHQQQTQ---SQSVYRDLS--PTTLAAVSDADLKYDSGPYNAAISSTYPSALRPNVVDSTTS 466
            ||.:..:.||   |||.|..|.  |:                |::..|..||.|| |:.....|.
 Frog   254 SHDSCDRLTQSWSSQSSYNSLQRVPS----------------YDSFDSEDYPPAL-PSHKSKGTF 301

  Fly   467 SD-----AELRLDQFYASNGISTSSNGQAISQRRGSLQLWQFLVALLDEPTTSASC---IAWTGR 523
            .|     |||..|:............|.      |.:||||||:.||    |..||   |:|||.
 Frog   302 KDYVRDRAELNKDKPVIPAAALAGYTGS------GPIQLWQFLLELL----TDKSCQSFISWTGD 356

  Fly   524 GMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNGERYVYRFVCDPDAL 585
            |.||||.:|:|||||||.:||:|.|||:||||.|||||:|.|:.|..|:|||||||||..:|
 Frog   357 GWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets96BNP_996290.1 ETS 497..583 CDD:197710 56/88 (64%)
ets1NP_001123840.1 SAM_PNT-ETS-1 49..136 CDD:176092
ETS 331..415 CDD:197710 55/87 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.