DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and AT1G74240

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_177564.2 Gene:AT1G74240 / 843764 AraportID:AT1G74240 Length:364 Species:Arabidopsis thaliana


Alignment Length:288 Identity:71/288 - (24%)
Similarity:126/288 - (43%) Gaps:34/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LFPLTVIKTQLQ---VQHKSDVYKGMVDCAMKIYRSEGVPGLYRGFWIS-SVQIVSGVFYISTYE 117
            :.|:..:||:||   :.:.:...|.::.....::..:|:.|.|||.... :..:.:|..|....|
plant    50 MHPVDTLKTRLQSQIIMNATQRQKSILQMLRTVWVGDGLKGFYRGIAPGVTGSLATGATYFGFIE 114

  Fly   118 GVRHVLNDLG---AGHRMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGI 179
            ..:..:.:..   |||....:| |.....:|..|.||.:||.|...:.|.|:...|....|.:.:
plant   115 STKKWIEESHPSLAGHWAHFIA-GAVGDTLGSFIYVPCEVIKQRMQIQGTSSSWSSYISRNSVPV 178

  Fly   180 KSWPGRSRLHISM-DIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQD------ELF 237
            :........:..| ..|..|.:..|.:|.|.||.::|...||.:.:...||...:|      :.|
plant   179 QPRGDMYGYYTGMFQAGCSIWKEQGPKGLYAGYWSTLARDVPFAGLMVVFYEGLKDLTDQGKKKF 243

  Fly   238 RICPVWVSHLFIQ-CVAGSLGGFTTTILTNPLDIVRARLQVHR--------LDSMSVAFRELWQE 293
               |.:..:..|: .|.|.|.|..:..||.|||:|:.||||..        ||::.    ::|::
plant   244 ---PQYGVNSSIEGLVLGGLAGGLSAYLTTPLDVVKTRLQVQGSTIKYKGWLDAVG----QIWRK 301

  Fly   294 EKLNCFFKGLSARL---VQSAAFSFSII 318
            |....||:|...|:   :.::|.:|..:
plant   302 EGPQGFFRGSVPRVMWYLPASALTFMAV 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 14/71 (20%)
Mito_carr 132..238 CDD:395101 27/112 (24%)
Mito_carr 245..327 CDD:395101 25/86 (29%)
AT1G74240NP_177564.2 Mito_carr 28..120 CDD:278578 14/69 (20%)
PTZ00168 34..332 CDD:185494 71/288 (25%)
Mito_carr 131..235 CDD:278578 26/104 (25%)
Mito_carr 265..339 CDD:278578 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1102784at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.