DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5805 and CG1907

DIOPT Version :9

Sequence 1:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:305 Identity:73/305 - (23%)
Similarity:122/305 - (40%) Gaps:48/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NKTKFFPLSMLSSFSVRCCLFPLTVIKTQLQVQHKSD---VYKGMVDCAMKIYRSEGVPGLYRGF 99
            |..||. ...||.......:.||.::||::|:.....   .|:..:.|...|...||...||:|.
  Fly    17 NAIKFL-FGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGI 80

  Fly   100 WISSVQIVSGVFYISTYEGVRHVLNDLGAGHRMK---------ALAGGGCASLVGQTIIVPFDVI 155
               ...::....|.:...|:...||||   .|.|         ::|.|..|...|..|..|.:| 
  Fly    81 ---GAALLRQATYTTGRLGMYTYLNDL---FREKFQRSPGITDSMAMGTIAGACGAFIGTPAEV- 138

  Fly   156 SQHAMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASL-MAYV 219
               |:|     ...|.|.: |:..:    |:..:::..:.| |.|.:|....:||...:: .|.|
  Fly   139 ---ALV-----RMTSDGRL-PVAER----RNYTNVANALAR-ITREEGLTALWRGSLPTVGRAMV 189

  Fly   220 PNSAMWWAFYHLYQDELFRICPVWVSH-LFIQCVAGSLGGFTTTILTNPLDIVRARLQVHRLDSM 283
            .|... .|.|..:: ..||..|:.:.. :.:...|..|.|..|||.:.||||.:.|:|..::...
  Fly   190 VNMTQ-LASYSQFK-TYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDG 252

  Fly   284 SVAFR-------ELWQEEKLNCFFKGLS---ARLVQSAAFSFSII 318
            ...:|       .:.::|.:...:||.:   .||......:|.|:
  Fly   253 KPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIIL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 18/81 (22%)
Mito_carr 132..238 CDD:395101 25/115 (22%)
Mito_carr 245..327 CDD:395101 20/85 (24%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 25/98 (26%)
Mito_carr 118..207 CDD:278578 25/105 (24%)
Mito_carr 219..307 CDD:278578 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.